PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g49970.1.p
Common NameBRADI_3g49970, LOC100830017
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 307aa    MW: 32908.4 Da    PI: 6.0731
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g49970.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.3e-161562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l d++ ++G g+W++ ++++g+ R +k+c++rw +yl
  Bradi3g49970.1.p 15 KGLWSPEEDQKLRDYILRHGHGCWSALPAKIGLQRNGKSCRLRWINYL 62
                      678*******************************************97 PP

2Myb_DNA-binding49.78.5e-1669113248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       g +++ E+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
  Bradi3g49970.1.p  69 GMFSPAEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 113
                       5699*****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1151062IPR017930Myb domain
SuperFamilySSF466893.37E-2812109IPR009057Homeodomain-like
SMARTSM007171.3E-111464IPR001005SANT/Myb domain
PfamPF002494.5E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-211669IPR009057Homeodomain-like
CDDcd001676.89E-111862No hitNo description
PROSITE profilePS5129424.12163117IPR017930Myb domain
SMARTSM007178.2E-1367115IPR001005SANT/Myb domain
PfamPF002492.8E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-2570117IPR009057Homeodomain-like
CDDcd001671.04E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGCKACEKPR PNYRKGLWSP EEDQKLRDYI LRHGHGCWSA LPAKIGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSPAEEETVM SLHAALGNKW SRIARHLPGR TDNEVKNYWN SYLKKRVESG  120
KQGPDAAAPT AADSAADSDG SQSTNPTGET AQEPASRPSN SGSSEPHHES YSSADSSCLT  180
VTEPPPPAPA CRPHAPVAPK VMFADWLDMD YINGGQMSAA APGLADAAGV VGAAASASPG  240
DHHHQAVMSQ GSAQVDGPPC SVNDSLHGFG DNGTCWEFQE QFDSMDQMQV GSFCDLLSVN  300
EFFGLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25111193110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569964.10.0PREDICTED: transcription factor LAF1
TrEMBLI1IC030.0I1IC03_BRADI; Uncharacterized protein
STRINGBRADI3G49970.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.18e-57myb domain protein 19